Anedot is hiring a
Remote Frontend Software Engineering Architect

📍 Remote

Impactful, Permanently Remote Work at Anedot.

Company: Anedot, Inc.
Organization: Engineering
Team: Frontend
Reports to: VP, Engineering
Experience Level: Principal
Type: Full-time, exempt; at-will
Location: Permanently remote
Base Comp Range: $170,000 - $220,000 annual
Perks/Benefits: $10,000 - $15,000 plus 401(k) with match
Base PTO: 30 days per year (15 days, plus 10 holidays, plus 5 floating holidays)

Join us as a Frontend Software Architect, where you'll take ownership of the frontend, working closely with our Founder/CEO, engineers, and design team. This is a primarily coding role, requiring extreme ownership and technical excellence to deliver a groundbreaking product.

Responsibilities

  1. Architect Solutions: Define and implement the technical direction of a greenfield project, serving as the lead architect for the frontend.
  2. Collaborate Cross-Functionally: Work closely with engineers, designers, and other team members to create seamless, high-quality user experiences.
  3. Implement Payment Systems: Develop and integrate major payment systems like Stripe or similar platforms to ensure seamless financial transactions.
  4. Foster Design Consistency: Build and maintain a robust Figma component library integration to ensure consistency across the platform.
  5. Write “Better Software Faster”: Defining and advocating type and testing strategies that allow the codebase to evolve safely and quickly without locking teams into brittle architectures or letting regressions slip through.
  6. Drive Strategic Decisions: Actively participate in discussions on frontend architecture, data modeling, and API design to align with the project’s vision.
  7. Share Expertise Through Code: Mentor team members and elevate technical capabilities by writing exemplary, production-ready code.

Qualifications

  1. 10+ years of professional experience in JavaScript development, with a strong emphasis on ReactJS with at least 5 years at one company.
  2. Proven experience architecting and leading large-scale frontend projects from inception to deployment.
  3. Strong foundational knowledge in computer science principles, including algorithms, data structures, and system design.
  4. Proficiency in Figma component libraries and translating designs into high-quality, scalable code.
  5. Significant experience implementing and integrating major payment platforms like Stripe or similar systems.
  6. Deep understanding of RESTful APIs, with the ability to design and consume them effectively.
  7. Firm commitment to automated testing and domain modeling with types in order to maintain high-quality, maintainable codebases.
  8. Demonstrated ability to take extreme ownership of projects while balancing hands-on coding with strategic technical decisions.
  9. Strong interpersonal and communication skills, with the ability to assert expertise while maintaining a collaborative team environment.

Requirements

  • TypeScript/Strong Typing in Javascript: 5 - 10 years
  • Frontend Performance & Optimization: 10+ years
  • Leading Component & Design Systems: 10+ years
  • API Design, GraphQL, Rest: 10+ years
  • Business / Stakeholder Communication
  • Negotiation & Consensus Building
  • User Experience Advocacy

About Us

We started Anedot in 2010 and now are launching a major payment processing and finance product aimed at empowering organizations through innovation, scalability, and world-class user experiences. This is a greenfield project, offering you the chance to make foundational architectural decisions and have a significant impact on a highly visible and transformative platform. We are a low-meeting and little bureaucracy organization - we don’t have time for that.


How to Apply

If you are a seasoned software engineer who thrives in ownership-driven, fast-paced environments and is passionate about building innovative solutions, we’d love to hear from you!


Hiring Process

  1. Fill out a job Application (whether direct or via recruiter)
  2. Pair Programming Interview - be prepared to write code with a shared screen using TDD
  3. One hour video interview with our Founder and CEO
Please note that we’re unable to offer individual feedback during the screening process.
FRONT ENDREMOTEJAVASCRIPTTYPESCRIPTGRAPHQLAPIFULL STACKSOFTWARE DEVELOPMENT
Anedot Logo
💵 Salary: $170,000 - $220,000
📍 Location: Remote
Apply Now
Receive updates on similar jobs:
Related Jobs:

Want weekly Christian tech job updates?

Sign up for our newsletter to stay up to date with all of the latest Christian tech jobs.